Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbm28 Peptide - C-terminal region

Rbm28 Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rbm28 Rabbit Polyclonal Antibody (orb577822) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

AAH18373

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKKQQLASSVQAPKRKAKENKAEARFNQLVEQYKQKLLGPSKGAPLMKRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tigar Rat shRNA Plasmid (Locus ID 502894)
TR702853 1 Kit

Tigar Rat shRNA Plasmid (Locus ID 502894)

Sign In for Pricing
View Details
Rabbit Polyclonal p62/SQSTM1 Antibody [Allophycocyanin]
NBP1-49955APC 0.1 mL

Rabbit Polyclonal p62/SQSTM1 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
DLX1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
18295111 3x 1.0 µg

DLX1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
SERBP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV714900 1.0 µg DNA

SERBP1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
L-Alanine
22302418-100g 100 g

L-Alanine

Sign In for Pricing
View Details
Recombinant Human TLR2 Protein
MBS286191-01 0.1 mg

Recombinant Human TLR2 Protein

Sign In for Pricing
View Details