Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rpl23a Peptide - C-terminal region

Rpl23a Peptide - C-terminal region

Product Specifications

Product Name Alternative

BC029892, MDA20

UniProt

P62751

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rpl23a Rabbit Polyclonal Antibody (orb577961) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997406

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Linaroside
DCA45212-01 25 mg

Linaroside

Sign In for Pricing
View Details
Linaroside
DCA45212-02 50 mg

Linaroside

Sign In for Pricing
View Details
Anti-MKP-4 antibody
STJ94140 200 µl

Anti-MKP-4 antibody

Sign In for Pricing
View Details
GC1q R Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61312R-BF488-01 20 µL

GC1q R Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
GC1q R Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61312R-BF488-02 100 µL

GC1q R Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Plant Thyroid Hormone Receptor Alpha (THRA) ELISA Kit
MBS9373399 Inquire

Plant Thyroid Hormone Receptor Alpha (THRA) ELISA Kit

Sign In for Pricing
View Details