Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rpl23a Peptide - C-terminal region

Rpl23a Peptide - C-terminal region

Product Specifications

Product Name Alternative

BC029892, MDA20

UniProt

P62751

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rpl23a Rabbit Polyclonal Antibody (orb577961) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997406

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVKANKHQIKQAVKKLYDIDVAKVNTLIRPDGEKKAYVRLAPDYDALDVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFRA1 ELISA Kit (Human) (OKBB01436)
OKBB01436 96 Well

GFRA1 ELISA Kit (Human) (OKBB01436)

Sign In for Pricing
View Details
Phosphoinositide 3 Kinase, p110 delta (PI3K) (Biotin) discontinued
P4073-26B-Biotin 100 µL

Phosphoinositide 3 Kinase, p110 delta (PI3K) (Biotin) discontinued

Sign In for Pricing
View Details
SpeD Antibody
orb832085 2 mg

SpeD Antibody

Sign In for Pricing
View Details
Minimum Essential Medium Eagle (MEM) w/ Hanks' Salts and L-Glutamine w/o Sodium bicarbonate
AT1056-01 1 L

Minimum Essential Medium Eagle (MEM) w/ Hanks' Salts and L-Glutamine w/o Sodium bicarbonate

Sign In for Pricing
View Details
Minimum Essential Medium Eagle (MEM) w/ Hanks' Salts and L-Glutamine w/o Sodium bicarbonate
AT1056-02 10x 1 L

Minimum Essential Medium Eagle (MEM) w/ Hanks' Salts and L-Glutamine w/o Sodium bicarbonate

Sign In for Pricing
View Details
Minimum Essential Medium Eagle (MEM) w/ Hanks' Salts and L-Glutamine w/o Sodium bicarbonate
AT1056-03 20 L

Minimum Essential Medium Eagle (MEM) w/ Hanks' Salts and L-Glutamine w/o Sodium bicarbonate

Sign In for Pricing
View Details