Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdc25b Peptide - middle region

Cdc25b Peptide - middle region

Product Specifications

Product Name Alternative

AI604853

UniProt

P30306

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdc25b Rabbit Polyclonal Antibody (orb578007) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075606

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEEEQDLIMFSKCQRLFRSPSMPCSVIRPILKRLERPQDRDVPVQSKRRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Salmonella
501080 20 Tests/Box

Salmonella

Sign In for Pricing
View Details
Rat IgG1, kappa Isotype Control (Alexa Fluor 647 Conjugated)
MBS2557822-01 20 Tests

Rat IgG1, kappa Isotype Control (Alexa Fluor 647 Conjugated)

Sign In for Pricing
View Details
Rat IgG1, kappa Isotype Control (Alexa Fluor 647 Conjugated)
MBS2557822-02 100 Tests

Rat IgG1, kappa Isotype Control (Alexa Fluor 647 Conjugated)

Sign In for Pricing
View Details
Rat IgG1, kappa Isotype Control (Alexa Fluor 647 Conjugated)
MBS2557822-03 2x 100 Tests

Rat IgG1, kappa Isotype Control (Alexa Fluor 647 Conjugated)

Sign In for Pricing
View Details
Rat IgG1, kappa Isotype Control (Alexa Fluor 647 Conjugated)
MBS2557822-04 10x 100 Tests

Rat IgG1, kappa Isotype Control (Alexa Fluor 647 Conjugated)

Sign In for Pricing
View Details
Endothelin Pan Specific DuoSet
DY1160 15 Plates

Endothelin Pan Specific DuoSet

Sign In for Pricing
View Details