Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cdc25b Peptide - middle region

Cdc25b Peptide - middle region

Product Specifications

Product Name Alternative

AI604853

UniProt

P30306

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cdc25b Rabbit Polyclonal Antibody (orb578007) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_075606

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEEEQDLIMFSKCQRLFRSPSMPCSVIRPILKRLERPQDRDVPVQSKRRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ceacam10 (NM_007675) AAV Particle
MR203512A1V 250 µL

Mouse Ceacam10 (NM_007675) AAV Particle

Sign In for Pricing
View Details
AKR1C4 Protein Vector (Human) (pPM-C-His)
PV001244 500 ng

AKR1C4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Lp-PLA2-IN-6
MBS5806301 Inquire

Lp-PLA2-IN-6

Sign In for Pricing
View Details
Rabbit Polyclonal PDE11A Antibody
NBP3-12443 100 µg

Rabbit Polyclonal PDE11A Antibody

Sign In for Pricing
View Details
ARPM1 (Actin Related Protein M1, MGC15664)
243506 100 µg

ARPM1 (Actin Related Protein M1, MGC15664)

Sign In for Pricing
View Details
GPR37L1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
22563154 3x 1.0 µg DNA

GPR37L1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details