Pcmtd2 Peptide - C-terminal region
Pcmtd2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
5330414D10Rik, AI314201
UniProt
Q8BHD8
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pcmtd2 Rabbit Polyclonal Antibody (orb325422) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_705822
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LDKEVFASRISNPSDDTSCEDAEEDRREVAERTLQETKPEPPVNFLRQRV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Tide Quencher™ 7.1WS amine [TQ7.1WS amine]](https://cdn.genprice.uk/products/271/11579489/imageurl/2115-aat.webp)
![galectin 9 (LGALS9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D12]](https://cdn.genprice.uk/products/937/68dd1b7d061270361ea1cfbd/imageurl/ta806323am.webp)
TA806323AM 100 µL
galectin 9 (LGALS9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D12]
Sign In for Pricing
View Details ![Neuropeptide Y (NPY) Mouse Monoclonal Antibody [Clone ID: OTI8F8]](https://cdn.genprice.uk/products/937/68dd18b9061270361e9082c5/imageurl/cf808282.webp)
CF808282 100 µg
Neuropeptide Y (NPY) Mouse Monoclonal Antibody [Clone ID: OTI8F8]
Sign In for Pricing
View Details 
PKSH031642-01 100 µg
Recombinant Human PD-1/PDCD1 Protein (His Tag)
Sign In for Pricing
View Details