Pcmtd2 Peptide - C-terminal region
Pcmtd2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
5330414D10Rik, AI314201
UniProt
Q8BHD8
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pcmtd2 Rabbit Polyclonal Antibody (orb325422) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_705822
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LDKEVFASRISNPSDDTSCEDAEEDRREVAERTLQETKPEPPVNFLRQRV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP306813M 100 µg
CAMKIV (CAMK4) (NM_001744) Human Recombinant Protein
Sign In for Pricing
View Details