Lrrc19 Peptide - middle region
Lrrc19 Peptide - middle region
Product Specifications
Product Name Alternative
9130022A01Rik, AI314124, AL022954, AW261791
UniProt
Q8BZT5
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Lrrc19 Rabbit Polyclonal Antibody (orb580854) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_780514
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LTWTSEHEPLGKSWAFLVGVVATVLLTSLLIFIAIKCPVWYNILLSYNHH
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7240435-01 48 Well
Guinea pig Actin Related protein 2/3 complex subunit 4 ELISA Kit
Sign In for Pricing
View Details 
MBS7240435-02 96 Well
Guinea pig Actin Related protein 2/3 complex subunit 4 ELISA Kit
Sign In for Pricing
View Details 
MBS7240435-03 5x 96 Well
Guinea pig Actin Related protein 2/3 complex subunit 4 ELISA Kit
Sign In for Pricing
View Details MBS7240435-04 10x 96 Well
Guinea pig Actin Related protein 2/3 complex subunit 4 ELISA Kit
Sign In for Pricing
View Details