Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dlk2 Peptide - C-terminal region

Dlk2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI413481, Egfl9

UniProt

Q8K1E3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dlk2 Rabbit Polyclonal Antibody (orb580864) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997549

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human 5-hydroxytryptamine receptor 4 (HTR4)
MBS7017307-01 0.02 mg

Recombinant Human 5-hydroxytryptamine receptor 4 (HTR4)

Sign In for Pricing
View Details
Recombinant Human 5-hydroxytryptamine receptor 4 (HTR4)
MBS7017307-02 0.1 mg

Recombinant Human 5-hydroxytryptamine receptor 4 (HTR4)

Sign In for Pricing
View Details
Recombinant Human 5-hydroxytryptamine receptor 4 (HTR4)
MBS7017307-03 5x 0.1 mg

Recombinant Human 5-hydroxytryptamine receptor 4 (HTR4)

Sign In for Pricing
View Details
SLC1A5 Rabbit Polyclonal Antibody
TA317316 50 µg

SLC1A5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARPP-19 HDR Plasmid (m)
sc-425585-HDR 20 µg

ARPP-19 HDR Plasmid (m)

Sign In for Pricing
View Details
Bremelanotide Acetate 50mg
A18241-50 50 mg

Bremelanotide Acetate 50mg

Sign In for Pricing
View Details