Dlk2 Peptide - C-terminal region
Dlk2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
AI413481, Egfl9
UniProt
Q8K1E3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Dlk2 Rabbit Polyclonal Antibody (orb580864) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_997549
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6162596-01 0.1 mL
MLLT6 (Myeloid/Lymphoid or Mixed-Lineage Leukemia (Trithorax Homolog, Drosophila); Translocated to, 6, AF17, FLJ23480) (AP)
Sign In for Pricing
View Details MBS6162596-02 5x 0.1 mL
MLLT6 (Myeloid/Lymphoid or Mixed-Lineage Leukemia (Trithorax Homolog, Drosophila); Translocated to, 6, AF17, FLJ23480) (AP)
Sign In for Pricing
View Details 
K6453908 1.0 µg DNA
Clca4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
Sign In for Pricing
View Details 
orb501355 100 µL
Phospho-Tyk2 (Tyr1054 + Tyr1055) Rabbit Polyclonal Antibody (Biotin)
Sign In for Pricing
View Details