Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zmat1 Peptide - middle region

Zmat1 Peptide - middle region

Product Specifications

Product Name Alternative

A230096A06, AW990744, B930008K04Rik

UniProt

G5E8E4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zmat1 Rabbit Polyclonal Antibody (orb581192) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_780655

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HNLPAESKTYDSFQDELEDYIKGQKARGLDPNTSFRRMSESYRYRDQRYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM184A CRISPR Activation Plasmid (m)
sc-429231-ACT 20 µg

FAM184A CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
Vmn1r91 sgRNA CRISPR Lentivector set (Mouse)
K3078701 3x 1.0 µg

Vmn1r91 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Dacetuzumab Biosimilar - Research Grade
ICH5030-5mg 5 mg

Dacetuzumab Biosimilar - Research Grade

Sign In for Pricing
View Details
APC/XFD750 Anti-human/ non-human primates CD83 Antibody *HB15e*
108301E0-AAT 25 Tests

APC/XFD750 Anti-human/ non-human primates CD83 Antibody *HB15e*

Sign In for Pricing
View Details
Tpsab1 sgRNA CRISPR Lentivector set (Mouse)
K4408801 3x 1.0 µg

Tpsab1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Fam229b (NM_183254) Mouse Tagged ORF Clone
MR212932 10 µg

Fam229b (NM_183254) Mouse Tagged ORF Clone

Sign In for Pricing
View Details