Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zmat1 Peptide - middle region

Zmat1 Peptide - middle region

Product Specifications

Product Name Alternative

A230096A06, AW990744, B930008K04Rik

UniProt

G5E8E4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zmat1 Rabbit Polyclonal Antibody (orb581192) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_780655

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HNLPAESKTYDSFQDELEDYIKGQKARGLDPNTSFRRMSESYRYRDQRYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLCXD3 Human Pre-designed siRNA Set A
HY-RS10668 1 Set

PLCXD3 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Comb for 36 samples, 1.5 mm thick
CGMX36-1.5 1 Unit

Comb for 36 samples, 1.5 mm thick

Sign In for Pricing
View Details
Cytoglobin (CYGB) (N-term) Rabbit Polyclonal Antibody
AP51162PU-N 400 µL

Cytoglobin (CYGB) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Spectrin alpha Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-62985R-PE-Cy5.5 100 µL

Spectrin alpha Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
MGAM Rabbit pAb
MBS9142856-01 0.02 mL

MGAM Rabbit pAb

Sign In for Pricing
View Details
MGAM Rabbit pAb
MBS9142856-02 0.1 mL

MGAM Rabbit pAb

Sign In for Pricing
View Details