NUP50 Peptide - N-terminal region
NUP50 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Rtp60, Npap60
UniProt
O08587
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NUP50 Rabbit Polyclonal Antibody (orb325727) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_037123
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VEEMGTFSVASEEVMKNRAVKKAKRRNIGFESDSGGAFKGFKGLVVPSGG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940177-500 1x 500 µL
CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 