Cyp4x1 Peptide - C-terminal region
Cyp4x1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
A230025G20, CYP_a, Cyp4a28-ps
UniProt
Q6A152
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Cyp4x1 Rabbit Polyclonal Antibody (orb582875) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001003947
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GMTVVLSIWGLHHNPAVWNDPKVFDPLRFTKENSDQRHPCAFLPFSSGPR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC881073-500 1x 500 µL
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880994-100 1x 100 µL
TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 