Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Psma2 Peptide - C-terminal region

Psma2 Peptide - C-terminal region

Product Specifications

UniProt

P17220

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Psma2 Rabbit Polyclonal Antibody (orb583169) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058975

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC27 Polyclonal Antibody
E-AB-16327-01 20 µL

CDC27 Polyclonal Antibody

Sign In for Pricing
View Details
CDC27 Polyclonal Antibody
E-AB-16327-02 60 µL

CDC27 Polyclonal Antibody

Sign In for Pricing
View Details
CDC27 Polyclonal Antibody
E-AB-16327-03 120 µL

CDC27 Polyclonal Antibody

Sign In for Pricing
View Details
CDC27 Polyclonal Antibody
E-AB-16327-04 200 µL

CDC27 Polyclonal Antibody

Sign In for Pricing
View Details
Uncoated Human SOD2 (Superoxide Dismutase 2, Mitochondrial) ELISA Kit
E-UNEL-H0181-01 5x 96 Tests

Uncoated Human SOD2 (Superoxide Dismutase 2, Mitochondrial) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human SOD2 (Superoxide Dismutase 2, Mitochondrial) ELISA Kit
E-UNEL-H0181-02 15x 96 Tests

Uncoated Human SOD2 (Superoxide Dismutase 2, Mitochondrial) ELISA Kit

Sign In for Pricing
View Details