Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Psma2 Peptide - C-terminal region

Psma2 Peptide - C-terminal region

Product Specifications

UniProt

P17220

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Psma2 Rabbit Polyclonal Antibody (orb583169) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058975

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP4R2 Human Gene Knockout Kit (CRISPR)
KN220738BN 1 Kit

PPP4R2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Stomach
CR559391 5 µg

Tissue Total RNA, Stomach

Sign In for Pricing
View Details
Ptch2 Mouse Gene Knockout Kit (CRISPR)
KN514155 1 Kit

Ptch2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FOXI3 Goat Polyclonal Antibody
AP33415PU-N 100 µg

FOXI3 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Nogo Receptor Recombinant Rabbit Monoclonal Antibody [JE33-68]
HA722391 100 µL

Nogo Receptor Recombinant Rabbit Monoclonal Antibody [JE33-68]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Smooth muscle
CB522276 1 Block

Frozen Tissue Blocks, Smooth muscle

Sign In for Pricing
View Details