Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enah Peptide - C-terminal region

Enah Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI464316, AW045240, Mena, Ndpp1, WBP8

UniProt

E9QKR1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Enah Rabbit Polyclonal Antibody (orb583465) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001076589

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RRIAEKGSTIETEQKEDRNEDAEPITAKAPSTSTPEPTRKPWERTNTMNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPS12 Rabbit pAb
E45R18188N-50 50 µL

MRPS12 Rabbit pAb

Sign In for Pricing
View Details
DOT1L1 Double Nickase Plasmid (m)
sc-431556-NIC 20 µg

DOT1L1 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
F44B9.9 Antibody
orb802152 2 mg

F44B9.9 Antibody

Sign In for Pricing
View Details
Anti-Kv1.4/KCNA4 Antibody Picoband®, Carrier-free
PA2297-carrier-free 100 µg/Vial

Anti-Kv1.4/KCNA4 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
CRYGD, ID (CRYGD, CRYG4, Gamma-crystallin D, Gamma-D-crystallin, Gamma-crystallin 4)
MBS641725-01 0.2 mL

CRYGD, ID (CRYGD, CRYG4, Gamma-crystallin D, Gamma-D-crystallin, Gamma-crystallin 4)

Sign In for Pricing
View Details
CRYGD, ID (CRYGD, CRYG4, Gamma-crystallin D, Gamma-D-crystallin, Gamma-crystallin 4)
MBS641725-02 5x 0.2 mL

CRYGD, ID (CRYGD, CRYG4, Gamma-crystallin D, Gamma-D-crystallin, Gamma-crystallin 4)

Sign In for Pricing
View Details