Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enah Peptide - C-terminal region

Enah Peptide - C-terminal region

Product Specifications

Product Name Alternative

AI464316, AW045240, Mena, Ndpp1, WBP8

UniProt

E9QKR1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Enah Rabbit Polyclonal Antibody (orb583465) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001076589

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RRIAEKGSTIETEQKEDRNEDAEPITAKAPSTSTPEPTRKPWERTNTMNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-CCDC106 antibody
SL5711R-01 50 µL

Rabbit Anti-CCDC106 antibody

Sign In for Pricing
View Details
Rabbit Anti-CCDC106 antibody
SL5711R-02 100 µL

Rabbit Anti-CCDC106 antibody

Sign In for Pricing
View Details
MFSD11 Antibody; FITC conjugated
MBS7004602-01 0.05 mg

MFSD11 Antibody; FITC conjugated

Sign In for Pricing
View Details
MFSD11 Antibody; FITC conjugated
MBS7004602-02 0.1 mg

MFSD11 Antibody; FITC conjugated

Sign In for Pricing
View Details
MFSD11 Antibody; FITC conjugated
MBS7004602-03 5x 0.1 mg

MFSD11 Antibody; FITC conjugated

Sign In for Pricing
View Details
DCXR, ID (Sperm Surface Protein P34H, Carbonyl Reductase II, Kidney Dicarbonyl Reductase, kiDCR, Dicarbonyl/L-xylulose Reductase, L-xylulose Reductase, XR) (HRP)
MBS6472024-01 0.2 mL

DCXR, ID (Sperm Surface Protein P34H, Carbonyl Reductase II, Kidney Dicarbonyl Reductase, kiDCR, Dicarbonyl/L-xylulose Reductase, L-xylulose Reductase, XR) (HRP)

Sign In for Pricing
View Details