Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajc12 Peptide - middle region

Dnajc12 Peptide - middle region

Product Specifications

Product Name Alternative

Jdp1, mJDP1

UniProt

Q9R022

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnajc12 Rabbit Polyclonal Antibody (orb583612) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038916

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAEFKIRALECHPDKHPENSKAVETFQKLQKAKEILCNAESRARYDHWRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetylcholinesterase Reagent
DACEN25ML 100 Tests

Acetylcholinesterase Reagent

Sign In for Pricing
View Details
ent-Thiamphenicol-d3
TRC-T344212-1MG 1 mg

ent-Thiamphenicol-d3

Sign In for Pricing
View Details
PP4R1 (PPP4R1) Rabbit Polyclonal Antibody
TA362452 100 µL

PP4R1 (PPP4R1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MnlI, 150U
RE1296 150 U

MnlI, 150U

Sign In for Pricing
View Details
Recombinant Human XRP2/RP2 Protein (GST Tag)
PKSH031261 100 µg

Recombinant Human XRP2/RP2 Protein (GST Tag)

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-500 1x 500 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details