Dnajc12 Peptide - middle region
Dnajc12 Peptide - middle region
Product Specifications
Product Name Alternative
Jdp1, mJDP1
UniProt
Q9R022
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Dnajc12 Rabbit Polyclonal Antibody (orb583612) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_038916
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LAEFKIRALECHPDKHPENSKAVETFQKLQKAKEILCNAESRARYDHWRR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PDMH100102-01 20 µg
Recombinant Human Deoxyribonuclease 1/DNASE1 protein (His tag)
Sign In for Pricing
View Details PDMH100102-02 100 µg
Recombinant Human Deoxyribonuclease 1/DNASE1 protein (His tag)
Sign In for Pricing
View Details PDMH100102-03 500 µg
Recombinant Human Deoxyribonuclease 1/DNASE1 protein (His tag)
Sign In for Pricing
View Details PDMH100102-04 1 mg
Recombinant Human Deoxyribonuclease 1/DNASE1 protein (His tag)
Sign In for Pricing
View Details 