Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Preb Peptide - N-terminal region

Preb Peptide - N-terminal region

Product Specifications

Product Name Alternative

C85705

UniProt

Q9WUQ2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Preb Rabbit Polyclonal Antibody (orb583779) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057912

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGVHFLQLEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Hydroxybenzaldehyde-13C
TRC-H828972-25MG 25 mg

4-Hydroxybenzaldehyde-13C

Sign In for Pricing
View Details
SCD1 (SCD) Human Gene Knockout Kit (CRISPR)
KN209148BN 1 Kit

SCD1 (SCD) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SPINK8 (NM_001080525) Human Recombinant Protein
TP761021 50 µg

SPINK8 (NM_001080525) Human Recombinant Protein

Sign In for Pricing
View Details
ADA2a (TADA2A) (NM_001291918) Human Tagged ORF Clone
RG237330 10 µg

ADA2a (TADA2A) (NM_001291918) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human ATXN7L1 protein (His tag)
PDEH100967-01 20 µg

Recombinant Human ATXN7L1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human ATXN7L1 protein (His tag)
PDEH100967-02 100 µg

Recombinant Human ATXN7L1 protein (His tag)

Sign In for Pricing
View Details