Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Preb Peptide - N-terminal region

Preb Peptide - N-terminal region

Product Specifications

Product Name Alternative

C85705

UniProt

Q9WUQ2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Preb Rabbit Polyclonal Antibody (orb583779) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057912

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGVHFLQLEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Erythrocytes Mouse Monoclonal Antibody [Clone ID: OX-83]
AM31837BT-N 100 µg

Erythrocytes Mouse Monoclonal Antibody [Clone ID: OX-83]

Sign In for Pricing
View Details
PHACTR2 Human Gene Knockout Kit (CRISPR)
KN415312 1 Kit

PHACTR2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/3230), Biotin conjugate, 0.1mg/mL
BNCB3230-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3230), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF208 Human Gene Knockout Kit (CRISPR)
KN420711 1 Kit

ZNF208 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Streptavidin, CF®583R
#29086 1x 1 mg

Streptavidin, CF®583R

Sign In for Pricing
View Details
GSTO2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A12]
TA504083BM 100 µL

GSTO2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A12]

Sign In for Pricing
View Details