Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aldh2 Peptide - C-terminal region

Aldh2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Ahd-5, Ahd5

UniProt

P47738

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aldh2 Rabbit Polyclonal Antibody (orb330974) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033786

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pyruvate Kinase PKM, Recombinant, Mouse, aa1-531, His-Tag, Myc-Tag (Pkm)
518079-01 20 µg

Pyruvate Kinase PKM, Recombinant, Mouse, aa1-531, His-Tag, Myc-Tag (Pkm)

Sign In for Pricing
View Details
Pyruvate Kinase PKM, Recombinant, Mouse, aa1-531, His-Tag, Myc-Tag (Pkm)
518079-02 100 µg

Pyruvate Kinase PKM, Recombinant, Mouse, aa1-531, His-Tag, Myc-Tag (Pkm)

Sign In for Pricing
View Details
3-Chloro-5-fluoropyridin-2 (1H) -one
PC540001 250 mg

3-Chloro-5-fluoropyridin-2 (1H) -one

Sign In for Pricing
View Details
Anti-African malaria mosquito TEP15 Antibody, HRP Conjugate
DZ41334-HRP 200 µL/Vial

Anti-African malaria mosquito TEP15 Antibody, HRP Conjugate

Sign In for Pricing
View Details
Recombinant Shigella flexneri GTPase obg (obg)
MBS1468011-01 0.02 mg (E-Coli)

Recombinant Shigella flexneri GTPase obg (obg)

Sign In for Pricing
View Details
Recombinant Shigella flexneri GTPase obg (obg)
MBS1468011-02 0.02 mg (Yeast)

Recombinant Shigella flexneri GTPase obg (obg)

Sign In for Pricing
View Details