Cxxc5 Peptide - N-terminal region
Cxxc5 Peptide - N-terminal region
Product Specifications
Product Name Alternative
4930415K17Rik
UniProt
Q91WA4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Cxxc5 Rabbit Polyclonal Antibody (orb584118) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_598448
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MSSLGGGSQDAGGSSSSSNTNSSSGSGQKAGGTDKSTAVAATTAPTSVAD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470994-500 1x 500 µL
TNF alpha (J2D10), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740460-100 1x 100 µL
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details