Olfr3 Peptide - middle region
Olfr3 Peptide - middle region
Product Specifications
Product Name Alternative
MOR136-14, Y71
UniProt
Q60879
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Olfr3 Rabbit Polyclonal Antibody (orb326305) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_996786
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LGALLKLSCSDTSLNQLVIFTAGLAAIMLPFLCILISYGRIGFTILQVPT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC551922-500 1x 500 µL
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Phospho-PKA R2 (S99) Recombinant Rabbit Monoclonal Antibody [SC54-04]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea821e9/imageurl/et1610-29.webp)
ET1610-29 100 µL
Phospho-PKA R2 (S99) Recombinant Rabbit Monoclonal Antibody [SC54-04]
Sign In for Pricing
View Details