Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Olfr3 Peptide - middle region

Olfr3 Peptide - middle region

Product Specifications

Product Name Alternative

MOR136-14, Y71

UniProt

Q60879

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Olfr3 Rabbit Polyclonal Antibody (orb326305) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_996786

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGALLKLSCSDTSLNQLVIFTAGLAAIMLPFLCILISYGRIGFTILQVPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Total Phosphodiesterase (PDEs) Acitivity Colorimetric Assay Kit
E-BC-K782-M 96 T (40 samples)

Total Phosphodiesterase (PDEs) Acitivity Colorimetric Assay Kit

Sign In for Pricing
View Details
Sodium Bitartrate Monohydrate
TRC-S083928-50G 50 g

Sodium Bitartrate Monohydrate

Sign In for Pricing
View Details
GRIK4 Rabbit Polyclonal Antibody
HA500017 100 µL

GRIK4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Alpha-2-macroglobulin Mouse Monoclonal Antibody [8-B10]
M1510-23 100 µL

Alpha-2-macroglobulin Mouse Monoclonal Antibody [8-B10]

Sign In for Pricing
View Details
Phospho-ErbB3/HER3 (Y1289) Recombinant Rabbit Monoclonal Antibody [JE51-25]
HA722178 100 µL

Phospho-ErbB3/HER3 (Y1289) Recombinant Rabbit Monoclonal Antibody [JE51-25]

Sign In for Pricing
View Details
Human 14-3-3 theta (YWHAQ) activation kit by CRISPRa
GA107531 1 Kit

Human 14-3-3 theta (YWHAQ) activation kit by CRISPRa

Sign In for Pricing
View Details