Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cd248 Peptide - middle region

Cd248 Peptide - middle region

Product Specifications

Product Name Alternative

2610111G01Rik, AI842296, Cd164l1, Tem1

UniProt

Q91V98

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cd248 Rabbit Polyclonal Antibody (orb584502) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_473383

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGAVSCRCSEGFRLAADGHSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-AMPK beta 1 (Ser108) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-3026R-BF680-01 20 µL

Phospho-AMPK beta 1 (Ser108) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Phospho-AMPK beta 1 (Ser108) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-3026R-BF680-02 100 µL

Phospho-AMPK beta 1 (Ser108) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
FAM58A sgRNA CRISPR Lentivector (Human) (Target 2)
K0725703 1.0 µg DNA

FAM58A sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
DFNA55 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV722704 1.0 µg DNA

DFNA55 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Analytical Balance BBAL-107
BBAL-107 1 Unit

Analytical Balance BBAL-107

Sign In for Pricing
View Details
CLIA Kit for Ferroportin (FPN)
TRV-0045615-01 24 Tests

CLIA Kit for Ferroportin (FPN)

Sign In for Pricing
View Details