Cd248 Peptide - middle region
Cd248 Peptide - middle region
Product Specifications
Product Name Alternative
2610111G01Rik, AI842296, Cd164l1, Tem1
UniProt
Q91V98
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Cd248 Rabbit Polyclonal Antibody (orb584502) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_473383
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DGAVSCRCSEGFRLAADGHSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K3138705 3x 1.0 µg
Lct sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details 
GTR15219042 1 Vial
Lentiviral mouse Hcfc1r1 shRNA (UAS) - Lentiviral mouse Hcfc1r1 shRNA (UAS) (100)
Sign In for Pricing
View Details