RND3 Peptide - C-terminal region
RND3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ARHE, Rho8, RhoE, memB
UniProt
P61587
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RND3 Rabbit Polyclonal Antibody (orb584603) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005159
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKSCTV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GP-6401-20 1 mL
Colloidal Gold Conjugated Allomyrina dichotoma Lectin (Japanese Beetle) -Allo A-, 20nm
Sign In for Pricing
View Details 
