RND3 Peptide - C-terminal region
RND3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
ARHE, Rho8, RhoE, memB
UniProt
P61587
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RND3 Rabbit Polyclonal Antibody (orb584603) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005159
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKSCTV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC681931-500 1x 500 µL
CD3e (T-Cell Marker) (C3e/1931), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![CITED1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B8]](https://cdn.genprice.uk/products/937/6868c3d7994c49e6dc400116/imageurl/ta807131am.webp)
TA807131AM 100 µL
CITED1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B8]
Sign In for Pricing
View Details 
TA380190 100 µL
Phosphatidic acid phosphatase type 2B (PLPP3) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details ![galectin 9 (LGALS9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D12]](https://cdn.genprice.uk/products/937/68dd1b7d061270361ea1cfbd/imageurl/ta806323am.webp)
TA806323AM 100 µL
galectin 9 (LGALS9) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D12]
Sign In for Pricing
View Details 