Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP6 Peptide - middle region

MAP6 Peptide - middle region

Product Specifications

Product Name Alternative

MTAP6, N-STOP, STOP

UniProt

Q96JE9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAP6 Rabbit Polyclonal Antibody (orb326334) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149052

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IRSLYSEPFKEPPKVEKPSVQSSKPKKTSASHKPTRKAKDKQAVSGQAAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPG3A (atlastin GTPase 1, AD-FSP, FSP1, GBP3, SPG3, SPG3A, atlastin1) (Biotin)
252042-Biotin 100 µL

SPG3A (atlastin GTPase 1, AD-FSP, FSP1, GBP3, SPG3, SPG3A, atlastin1) (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal MMP-14/MT1-MMP Antibody (3G4.2) [HRP]
NBP2-29735H 0.1 mL

Mouse Monoclonal MMP-14/MT1-MMP Antibody (3G4.2) [HRP]

Sign In for Pricing
View Details
FGF4 Mouse Monoclonal Antibody
orb783102-01 50 μL

FGF4 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
FGF4 Mouse Monoclonal Antibody
orb783102-02 100 µL

FGF4 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Factor IX Antibody (044) [mFluor Violet 450 SE]
NBP2-89907MFV450 0.1 mL

Rabbit Monoclonal Factor IX Antibody (044) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Recombinant Escherichia coli Uncharacterized protein ybdN (ybdN)
MBS1155089-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Uncharacterized protein ybdN (ybdN)

Sign In for Pricing
View Details