Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP6 Peptide - middle region

MAP6 Peptide - middle region

Product Specifications

Product Name Alternative

MTAP6, N-STOP, STOP

UniProt

Q96JE9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAP6 Rabbit Polyclonal Antibody (orb326334) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_149052

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IRSLYSEPFKEPPKVEKPSVQSSKPKKTSASHKPTRKAKDKQAVSGQAAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adam19 ORF Vector (Mouse) (pORF)
11314014 1.0 µg DNA

Adam19 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Recombinant Vibrio Cholerae metK Protein (aa 1-385) (strain M66-2)
VAng-Cr3115-1mgEcoli 1 mg (E. coli)

Recombinant Vibrio Cholerae metK Protein (aa 1-385) (strain M66-2)

Sign In for Pricing
View Details
UNE Purified anti-mouse CD28
E16FMZ028-100U 100 µg

UNE Purified anti-mouse CD28

Sign In for Pricing
View Details
Quick Step Sheep Foot and Mouth Disease Virus (FMDV) elisa Kit
QS00055Sp-01 48 Tests

Quick Step Sheep Foot and Mouth Disease Virus (FMDV) elisa Kit

Sign In for Pricing
View Details
Quick Step Sheep Foot and Mouth Disease Virus (FMDV) elisa Kit
QS00055Sp-02 96 Tests

Quick Step Sheep Foot and Mouth Disease Virus (FMDV) elisa Kit

Sign In for Pricing
View Details
H2AFZ Antibody
MBS7119556-01 0.05 mg

H2AFZ Antibody

Sign In for Pricing
View Details