Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPKAPK2 Peptide - C-terminal region

MAPKAPK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MAPKAP-K2, MK-2, MK2

UniProt

P49137

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPKAPK2 Rabbit Polyclonal Antibody (orb331092) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004750

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKGCLHDKNSDQATWLTR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXO4 Human Knockdown Lysate
LY300003 100 µg

FOXO4 Human Knockdown Lysate

Sign In for Pricing
View Details
N1-(2-(Tritylthio)ethyl)propane-1,3-diamine
TRC-T890050-2.5G 2.5 g

N1-(2-(Tritylthio)ethyl)propane-1,3-diamine

Sign In for Pricing
View Details
Transcription factor Sp4 (SP4) Human Gene Knockout Kit (CRISPR)
KN417532 1 Kit

Transcription factor Sp4 (SP4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pigment Yellow 14
TRC-P437843-50MG 50 mg

Pigment Yellow 14

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/3143R), CF740 conjugate, 0.1mg/mL
BNC743143-500 1x 500 µL

Ubiquitin (Autophagy Marker) (UBB/3143R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Dlk1 activation kit by CRISPRa
GA201080 1 Kit

Mouse Dlk1 activation kit by CRISPRa

Sign In for Pricing
View Details