Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPKAPK2 Peptide - C-terminal region

MAPKAPK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MAPKAP-K2, MK-2, MK2

UniProt

P49137

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPKAPK2 Rabbit Polyclonal Antibody (orb331092) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004750

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKGCLHDKNSDQATWLTR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR4X1 Human Gene Knockout Kit (CRISPR)
KN421694 1 Kit

OR4X1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C7orf23 (TMEM243) Human Gene Knockout Kit (CRISPR)
KN401309 1 Kit

C7orf23 (TMEM243) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Adipic Acid Monoethyl Ester
TRC-A144890-25G 25 g

Adipic Acid Monoethyl Ester

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS702087 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
L1CAM Human Gene Knockout Kit (CRISPR)
KN211601LP 1 Kit

L1CAM Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mcur1 Rabbit Polyclonal Antibody
ER1902-30 100 µL

Mcur1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details