Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAMTOR3 Peptide - N-terminal region

LAMTOR3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MAP2K1IP1, MAPBP, MAPKSP1, MP1, PRO0633, Ragulator3

UniProt

Q9UHA4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LAMTOR3 Rabbit Polyclonal Antibody (orb326336) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_068805

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Sarcalumenin (Srl) , partial
MBS1400905 Inquire

Recombinant Mouse Sarcalumenin (Srl) , partial

Sign In for Pricing
View Details
Anti-Hu CD27 PE-Cyanine7
MBS1800903-01 100 Tests

Anti-Hu CD27 PE-Cyanine7

Sign In for Pricing
View Details
Anti-Hu CD27 PE-Cyanine7
MBS1800903-02 5x 100 Tests

Anti-Hu CD27 PE-Cyanine7

Sign In for Pricing
View Details
ACTH (18-39) (human)
4008985.0005 5 mg

ACTH (18-39) (human)

Sign In for Pricing
View Details
ROM-K (phospho Ser44) Polyclonal Antibody
E013554 100 µg -100 µL

ROM-K (phospho Ser44) Polyclonal Antibody

Sign In for Pricing
View Details
Hydrocortisone Acetate Impurity 37
RM-H040337-01 10 mg

Hydrocortisone Acetate Impurity 37

Sign In for Pricing
View Details