LAMTOR3 Peptide - N-terminal region
LAMTOR3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MAP2K1IP1, MAPBP, MAPKSP1, MP1, PRO0633, Ragulator3
UniProt
Q9UHA4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LAMTOR3 Rabbit Polyclonal Antibody (orb326336) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_068805
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TR311012 1 Kit
Sigma1 receptor (SIGMAR1) Human shRNA Plasmid Kit (Locus ID 10280)
Sign In for Pricing
View Details 
