Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPANXB1 Peptide - middle region

SPANXB1 Peptide - middle region

Product Specifications

Product Name Alternative

B1, CT11.2, SPANX-B, SPANXB

UniProt

Q9NS25

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPANXB1 Rabbit Polyclonal Antibody (orb584792) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115850

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSPEELVNDHARE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 1-thio-α-L-rhamnopyranoside
GC6710-1g 1 g

Ethyl 1-thio-α-L-rhamnopyranoside

Sign In for Pricing
View Details
Guinea Pig Tumor Necrosis Factor Alpha ELISA kit
GTR10423135 96 Well

Guinea Pig Tumor Necrosis Factor Alpha ELISA kit

Sign In for Pricing
View Details
FPGT siRNA (Human)
orb1862467-01 15 nmol

FPGT siRNA (Human)

Sign In for Pricing
View Details
FPGT siRNA (Human)
orb1862467-02 30 nmol

FPGT siRNA (Human)

Sign In for Pricing
View Details
Recombinant Human RPRD1B Protein
E30P03976A 50 µg

Recombinant Human RPRD1B Protein

Sign In for Pricing
View Details
CD8 (Leu2 T lymphocyte antigen, MAL, OKT8 T Cell antigen, p32, T cell antigen Leu2, T cell surface glycoprotein CD8 alpha, Suppressor/Cytotoxic T cell) (APC) discontinued
C2259-07-APC 200 µL

CD8 (Leu2 T lymphocyte antigen, MAL, OKT8 T Cell antigen, p32, T cell antigen Leu2, T cell surface glycoprotein CD8 alpha, Suppressor/Cytotoxic T cell) (APC) discontinued

Sign In for Pricing
View Details