Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sf3b5 Peptide - C-terminal region

Sf3b5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

10kDa, 1110005L13Rik, AU043053, Sf3b10

UniProt

Q923D4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sf3b5 Rabbit Polyclonal Antibody (orb326372) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_780311

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPSGPPADKPEEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF2A1L 3'UTR GFP Stable Cell Line
TU059411 1.0 mL

GTF2A1L 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PFKP Human Over-expression Lysate
orb1378584 20 µg

PFKP Human Over-expression Lysate

Sign In for Pricing
View Details
GLTPD2-set siRNA/shRNA/RNAi Lentivector (Human)
21640091 4x 500 ng

GLTPD2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Purified Anti-Mouse CD3 Antibody
RD20264F-01 25 µg

Purified Anti-Mouse CD3 Antibody

Sign In for Pricing
View Details
Purified Anti-Mouse CD3 Antibody
RD20264F-02 100 µg

Purified Anti-Mouse CD3 Antibody

Sign In for Pricing
View Details
Isotype Control, B-Z1; IgG1; Biotin
M857074010 100 Tests / 1 mL

Isotype Control, B-Z1; IgG1; Biotin

Sign In for Pricing
View Details