Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sf3b5 Peptide - C-terminal region

Sf3b5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

10kDa, 1110005L13Rik, AU043053, Sf3b10

UniProt

Q923D4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sf3b5 Rabbit Polyclonal Antibody (orb326372) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_780311

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPSGPPADKPEEN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GABRQ knockdown cell line
ABC-KD5843 1 Vial

Human GABRQ knockdown cell line

Sign In for Pricing
View Details
HIST1H2AK Protein Vector (Human) (pPB-C-His)
PV053045 500 ng

HIST1H2AK Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Anti-Human CD194/CCR4 Antibody (SAA0069)
HW634107 100 µg

Anti-Human CD194/CCR4 Antibody (SAA0069)

Sign In for Pricing
View Details
Caveolin-1 (Tyr-14), Phosphospecific Antibody
bsm-70392M 100 µL

Caveolin-1 (Tyr-14), Phosphospecific Antibody

Sign In for Pricing
View Details
Recombinant Human TOM1L2 Protein, His, E.coli-2ug
QP13781-2ug 2ug

Recombinant Human TOM1L2 Protein, His, E.coli-2ug

Sign In for Pricing
View Details
Gldc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
21593114 3x 1.0 µg

Gldc sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details