Map2k1 Peptide - N-terminal region
Map2k1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
MAPKK1, MEKK1, Mek1, Prkmk1
UniProt
P31938
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Map2k1 Rabbit Polyclonal Antibody (orb584884) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_032953
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
P011-405M-500 1x 500 µL
CD16 Mouse Monoclonal Antibody (3G8), CF®405M Conjugate - Biotium Choice
Sign In for Pricing
View Details 
BNC882473-500 1x 500 µL
CD3e (T-Cell Marker) (UCHT1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details