Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Map2k1 Peptide - N-terminal region

Map2k1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MAPKK1, MEKK1, Mek1, Prkmk1

UniProt

P31938

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Map2k1 Rabbit Polyclonal Antibody (orb584884) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032953

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF221 activation kit by CRISPRa
GA105242 1 Kit

Human ZNF221 activation kit by CRISPRa

Sign In for Pricing
View Details
Phenolphthalein b-D-Glucuronide (~90%)
TRC-P318015-50MG 50 mg

Phenolphthalein b-D-Glucuronide (~90%)

Sign In for Pricing
View Details
Mouse F5 activation kit by CRISPRa
GA201340 1 Kit

Mouse F5 activation kit by CRISPRa

Sign In for Pricing
View Details
MGST3 Rabbit Polyclonal Antibody
TA370470 100 µL

MGST3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2,6-Dibromoanthracene
TRC-B426375-10MG 10 mg

2,6-Dibromoanthracene

Sign In for Pricing
View Details
Polystyrene A COOH
HA40045003.5G 5 g

Polystyrene A COOH

Sign In for Pricing
View Details