Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pdgfc Peptide - N-terminal region

Pdgfc Peptide - N-terminal region

Product Specifications

Product Name Alternative

1110064L01Rik, AI647969, PDGF-C

UniProt

Q8CI19

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pdgfc Rabbit Polyclonal Antibody (orb585118) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064355

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-KSR1  (6C7)
YF-MA16554 100 ug

Anti-KSR1 (6C7)

Sign In for Pricing
View Details
EEF2KMT Rabbit Polyclonal Antibody
orb587394 100 µL

EEF2KMT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Heat shock protein beta-9 Antibody (Fluoro488)
orb3169326 100 µg

Heat shock protein beta-9 Antibody (Fluoro488)

Sign In for Pricing
View Details
SRD5A2 Recombinant Antibody, APC Conjugated
bsm-62269R-APC 100 µL

SRD5A2 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
Recombinant HPV-17 L1 Protein
VAng-Wyb3053-inquire Inquire

Recombinant HPV-17 L1 Protein

Sign In for Pricing
View Details
DOCK8 Antibody
orb1320715 100 µL

DOCK8 Antibody

Sign In for Pricing
View Details