Pdgfc Peptide - N-terminal region
Pdgfc Peptide - N-terminal region
Product Specifications
Product Name Alternative
1110064L01Rik, AI647969, PDGF-C
UniProt
Q8CI19
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pdgfc Rabbit Polyclonal Antibody (orb585118) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_064355
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPRHERVV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
033504-APC 200 µL
CD3EAP, NT (DNA-directed RNA polymerase I subunit RPA34, RNA polymerase I-associated factor PAF49, Anti-sense to ERCC-1 protein, ASE-1, CD3-epsilon-associated protein, CD3E-associated protein, CAST, A34.5, PAF49, CAST, ASE1, CD3EAP) (APC) discontinued
Sign In for Pricing
View Details 
MBS6405880-01 0.1 mL
AICDA (Activation-induced Cytidine Deaminase, AID, ARP2, CDA2, HIGM2) (MaxLight 750)
Sign In for Pricing
View Details MBS6405880-02 5x 0.1 mL
AICDA (Activation-induced Cytidine Deaminase, AID, ARP2, CDA2, HIGM2) (MaxLight 750)
Sign In for Pricing
View Details 