Pkn2 Peptide - C-terminal region
Pkn2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
6030436C20Rik, AI507382, PRK2, Prkcl2, Stk7
UniProt
Q8BWW9
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Pkn2 Rabbit Polyclonal Antibody (orb585153) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_848769
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LRRNPERRLGAGEKDAEDVKKHPFFRLTDWSALMDKKVKPPFVPTIRGRE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![BRCC36 (BRCC3) Mouse Monoclonal Antibody [Clone ID: AT3B1]](https://cdn.genprice.uk/products/937/68dd189b061270361e8fc405/imageurl/am09089pu-s.webp)
AM09089PU-S 50 µL
BRCC36 (BRCC3) Mouse Monoclonal Antibody [Clone ID: AT3B1]
Sign In for Pricing
View Details 
AP01600PU-N 100 µg
Her2 (ERBB2) pTyr1221/1222 Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNC941563-500 1x 500 µL
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
