Fuca2 Peptide - middle region
Fuca2 Peptide - middle region
Product Specifications
Product Name Alternative
0610025O11Rik, 5530401P20Rik
UniProt
Q99KR8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Fuca2 Rabbit Polyclonal Antibody (orb585323) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_080075
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SKTLPELYELVNRYQPEVLWSDGDGGAPDHYWNSTGFLAWLYNESPVRKT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
28364154 3x 1.0 µg DNA
MEP1B CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
Sign In for Pricing
View Details