Fuca2 Peptide - middle region
Fuca2 Peptide - middle region
Product Specifications
Product Name Alternative
0610025O11Rik, 5530401P20Rik
UniProt
Q99KR8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Fuca2 Rabbit Polyclonal Antibody (orb585323) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_080075
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SKTLPELYELVNRYQPEVLWSDGDGGAPDHYWNSTGFLAWLYNESPVRKT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1191763 Inquire
Recombinant Arthrobacter aurescens Protease HtpX homolog (htpX)
Sign In for Pricing
View Details 
46887121 3x 1.0µg DNA
TMEM132A CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details 
