Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cytip Peptide - C-terminal region

Cytip Peptide - C-terminal region

Product Specifications

Product Name Alternative

A130053M09Rik, AI462064, C80816, Cbp, Cybr, Pscdbp

UniProt

Q91VY6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cytip Rabbit Polyclonal Antibody (orb331183) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631939

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RNRSISVTSSGSFSPLWESNYSSVFGTLPRKSRRGSVRKQILKFIPGLHR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish Ush2c/adgrv1 C terminus Rabbit Polyclonal Antibody (PE)
orb2572479 200 µL

Zebrafish Ush2c/adgrv1 C terminus Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
EXOC6 Rabbit pAb, PerCP-Cy7 conjugated
orb2871861 100 µL

EXOC6 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Commd9 (NM_029635) Mouse Recombinant Protein
PM48379M5 20 µg

Commd9 (NM_029635) Mouse Recombinant Protein

Sign In for Pricing
View Details
Biotin anti-mouse IgG2b
E16SLB501-050U 50 µg

Biotin anti-mouse IgG2b

Sign In for Pricing
View Details
HDHD1A (Haloacid Dehalogenase-like Hydrolase Domain Containing 1A, DXF68S1E, FAM16AX, GS1) (Biotin)
246986-Biotin 100 µL

HDHD1A (Haloacid Dehalogenase-like Hydrolase Domain Containing 1A, DXF68S1E, FAM16AX, GS1) (Biotin)

Sign In for Pricing
View Details
DYNC1I2 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2552010 100 µL

DYNC1I2 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details