Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cytip Peptide - C-terminal region

Cytip Peptide - C-terminal region

Product Specifications

Product Name Alternative

A130053M09Rik, AI462064, C80816, Cbp, Cybr, Pscdbp

UniProt

Q91VY6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Cytip Rabbit Polyclonal Antibody (orb331183) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_631939

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RNRSISVTSSGSFSPLWESNYSSVFGTLPRKSRRGSVRKQILKFIPGLHR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS512338 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Recombinant Mouse Fzd1 protein (C-Fc)
CD00439-01 10 µg

Recombinant Mouse Fzd1 protein (C-Fc)

Sign In for Pricing
View Details
Recombinant Mouse Fzd1 protein (C-Fc)
CD00439-02 50 µg

Recombinant Mouse Fzd1 protein (C-Fc)

Sign In for Pricing
View Details
ATP6V1F (NM_004231) Human Recombinant Protein
TP310728M 100 µg

ATP6V1F (NM_004231) Human Recombinant Protein

Sign In for Pricing
View Details
Drg1 Rat shRNA Lentiviral Particle (Locus ID 305470)
TL701335V 500 µL Each

Drg1 Rat shRNA Lentiviral Particle (Locus ID 305470)

Sign In for Pricing
View Details
Mouse Monoclonal Filaggrin Antibody (FLG/1561) [DyLight 405]
NBP2-54366V 100 µL

Mouse Monoclonal Filaggrin Antibody (FLG/1561) [DyLight 405]

Sign In for Pricing
View Details