Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndufa8 Peptide - middle region

Ndufa8 Peptide - middle region

Product Specifications

Product Name Alternative

0610033L03Rik, AW261656

UniProt

Q9DCJ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ndufa8 Rabbit Polyclonal Antibody (orb585330) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080979

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEFMLCRWEEKDPRRCLKEGKLVNGCALNFFRQIKSHCAEPFTEYWTCLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS701273 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CD34 (HPCA1/763), CF405S conjugate, 0.1mg/mL
BNC040763-100 1x 100 µL

CD34 (HPCA1/763), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Assay Plates
DP110F-384-BLK-S-IWL 40 Packs/Case

Assay Plates

Sign In for Pricing
View Details
MRE11 Polyclonal Antibody
E-AB-15211-01 20 µL

MRE11 Polyclonal Antibody

Sign In for Pricing
View Details
MRE11 Polyclonal Antibody
E-AB-15211-02 60 µL

MRE11 Polyclonal Antibody

Sign In for Pricing
View Details
MRE11 Polyclonal Antibody
E-AB-15211-03 120 µL

MRE11 Polyclonal Antibody

Sign In for Pricing
View Details