Ndufa8 Peptide - middle region
Ndufa8 Peptide - middle region
Product Specifications
Product Name Alternative
0610033L03Rik, AW261656
UniProt
Q9DCJ5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ndufa8 Rabbit Polyclonal Antibody (orb585330) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_080979
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KEFMLCRWEEKDPRRCLKEGKLVNGCALNFFRQIKSHCAEPFTEYWTCLD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![MUSK Recombinant Rabbit Monoclonal Antibody [PSH02-29]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea8243d/imageurl/ha721809.webp)
HA721809 100 µL
MUSK Recombinant Rabbit Monoclonal Antibody [PSH02-29]
Sign In for Pricing
View Details 
BNCB0523-100 1x 100 µL
AFP (Alpha Fetoprotein) (C2), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details